PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID e_gw1.13.00.306.1
Common NameOT_ostta13g00110
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Bathycoccaceae; Ostreococcus
Family MYB
Protein Properties Length: 98aa    MW: 11286.8 Da    PI: 10.4546
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
e_gw1.13.00.306.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.82.4e-13141747
                       HHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding  7 eEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqky 47
                       +Ede l + +++lGg+ +W++Ia+ ++ gR+ k+c++rw + 
  e_gw1.13.00.306.1  1 QEDEMLREQIERLGGPgNWTAIAEALP-GRSSKSCRLRWCNQ 41
                       6**************************.***********985 PP

2Myb_DNA-binding56.56.3e-184892147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                       rg++T+eEd  ++  ++ +G++ W+ I+r+m+ gRt++q+k+r+++ 
  e_gw1.13.00.306.1 48 RGPFTPEEDNTILMQHAIHGNK-WAVISRYMP-GRTDNQVKNRFNST 92
                       89********************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd001678.25E-10140No hitNo description
Gene3DG3DSA:1.10.10.604.9E-22149IPR009057Homeodomain-like
SMARTSM007171.9E-5144IPR001005SANT/Myb domain
PfamPF002498.3E-12141IPR001005SANT/Myb domain
PROSITE profilePS5129414.46142IPR017930Myb domain
SuperFamilySSF466893.88E-292296IPR009057Homeodomain-like
PROSITE profilePS5129425.3134397IPR017930Myb domain
SMARTSM007173.7E-164795IPR001005SANT/Myb domain
PfamPF002494.4E-164892IPR001005SANT/Myb domain
CDDcd001678.73E-125093No hitNo description
Gene3DG3DSA:1.10.10.606.2E-255095IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 98 aa     Download sequence    Send to blast
QEDEMLREQI ERLGGPGNWT AIAEALPGRS SKSCRLRWCN QLNPNVKRGP FTPEEDNTIL  60
MQHAIHGNKW AVISRYMPGR TDNQVKNRFN STLRRLIA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3zqc_A1e-272989104MYB3
3zqc_D1e-272989104MYB3
3zqc_G1e-272989104MYB3
3zqc_J1e-272989104MYB3
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00337DAPTransfer from AT3G09230Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003082481.13e-67MYBY1 protein (ISS)
SwissprotQ9FDW11e-34MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A090M7263e-67A0A090M726_
STRINGQ00XH39e-67(Ostreococcus tauri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1516114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09230.18e-39myb domain protein 1
Publications ? help Back to Top
  1. Derelle E, et al.
    Genome analysis of the smallest free-living eukaryote Ostreococcus tauri unveils many unique features.
    Proc. Natl. Acad. Sci. U.S.A., 2006. 103(31): p. 11647-52
    [PMID:16868079]